DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and Prosalpha6

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster


Alignment Length:188 Identity:41/188 - (21%)
Similarity:74/188 - (39%) Gaps:30/188 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIADIV-A 75
            |..||..:.::.....|:.|..:.:|......|   |:..|.|.:....:|..||.:.::..: :
  Fly    29 VKLGTATVGLKNKDYAVLVALCKPTSELSDTQR---KIIPIDDHLGISIAGLTADARVLSRYLRS 90

  Fly    76 YSLNY-HENQTN--KDALVFEAASEFRNYCYSY-RESLLAGIIVAGWDEQRGGQVYSI-PLGGML 135
            ..||| |...|.  ...|:....::.:.....| |.....|::|||:|| ||..:|.: |.....
  Fly    91 ECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVGLLVAGYDE-RGPHIYQVTPSATFF 154

  Fly   136 TRESCTIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGI 193
            ..::.:||....|                  ..|:::|.:..  :.|.|...::|.||
  Fly   155 NCKANSIGSRSQS------------------ARTYLEKNLNK--FLDSSKDEIIRHGI 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 40/185 (22%)
proteasome_beta_type_6 16..203 CDD:239731 39/184 (21%)
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 41/188 (22%)
proteasome_alpha_type_1 6..219 CDD:239718 41/188 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.