DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and Prosbeta5R2

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster


Alignment Length:192 Identity:51/192 - (26%)
Similarity:83/192 - (43%) Gaps:9/192 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQPDFDFTDTPVSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAA 65
            :|.|||.       |||.:...:.||:::..|||.:||..:.::...|:.::...:....:|.||
  Fly    64 VQIDFDH-------GTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAA 121

  Fly    66 DTQAIADIVAYSLNYHENQTNKDALVFEAASEFRNYCYSYR-ESLLAGIIVAGWDEQRGGQVYSI 129
            |.......:......||.:..:...|..||....|....|: ..|..|:::|||..:....|| :
  Fly   122 DCTYWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEYKGMGLCMGMMLAGWSPEGPSLVY-V 185

  Fly   130 PLGGMLTRESCTIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRI 191
            ...|:.........|||:....|.:...||.:::..:.......||.||...|..||||||:
  Fly   186 DSNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSGGVVRL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 47/178 (26%)
proteasome_beta_type_6 16..203 CDD:239731 46/177 (26%)
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 51/192 (27%)
proteasome_beta_type_5 72..259 CDD:239730 46/177 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440963
Domainoid 1 1.000 44 1.000 Domainoid score I729
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.