DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and psmb9a

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_571466.1 Gene:psmb9a / 30665 ZFINID:ZDB-GENE-990415-140 Length:218 Species:Danio rerio


Alignment Length:206 Identity:103/206 - (50%)
Similarity:132/206 - (64%) Gaps:1/206 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PDFDFTDTPVSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADT 67
            |:..:....|.|||||:||.||||||||:|||.|:|..|.|||.:||:.:.||:||..||||||.
Zfish     7 PEPGWLSEEVKTGTTIIAVTFDGGVVIGSDSRVSAGESVVNRVMNKLSPLHDKIYCALSGSAADA 71

  Fly    68 QAIADIVAYSLNYHENQTNKDALVFEAASEFRNYCYSYRESLLAGIIVAGWDEQRGGQVYSIPLG 132
            |.||:||.|.|:.|..:...|.||..||:..:|..|.|:|.|.|.:||||||::.|||||: .|.
Zfish    72 QTIAEIVNYQLDVHSIEVEDDPLVCSAATLVKNISYKYKEELSAHLIVAGWDKKGGGQVYA-TLS 135

  Fly   133 GMLTRESCTIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKD 197
            |:||::...||||||.:|.|||...|:.||...:|..||..|:..|:..|||||||..:..|.||
Zfish   136 GLLTKQPFAIGGSGSFYINGFVDAEYKKNMTKRECQEFVVNALTLAMGRDGSSGGVAYVVTIDKD 200

  Fly   198 GIERRIFYNTE 208
            |.|.:.....|
Zfish   201 GTEEKCVLGNE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 98/185 (53%)
proteasome_beta_type_6 16..203 CDD:239731 98/186 (53%)
psmb9aNP_571466.1 20S_bact_beta 19..204 CDD:163402 98/185 (53%)
proteasome_beta_type_6 20..206 CDD:239731 98/186 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575762
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0174
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54145
OrthoDB 1 1.010 - - D1172133at2759
OrthoFinder 1 1.000 - - FOG0001868
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101390
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1014
SonicParanoid 1 1.000 - - X1224
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.