DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and Psmb10

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001020808.1 Gene:Psmb10 / 291983 RGDID:1307428 Length:273 Species:Rattus norvegicus


Alignment Length:185 Identity:61/185 - (32%)
Similarity:94/185 - (50%) Gaps:1/185 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIADIVAYSL 78
            |||||..:.|..||::|||:|.::.:.||::..:|:..|..|:|||.:|.||||:....:.|..:
  Rat    38 TGTTIAGLVFRDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADTEMTTRMAASKM 102

  Fly    79 NYHENQTNKDALVFEAASEFRNYCYSYRESLLAGIIVAGWDEQRGGQVYSIPLGGMLTRESCTIG 143
            ..|...|.::..|.......|...:.|:..:.|.:||.|.| ..|.|:||:...|..:|...|..
  Rat   103 ELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVD-LNGPQLYSVHPHGSYSRLPFTAL 166

  Fly   144 GSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDG 198
            |||.......:.:.::|||.||.....:.:|:...|..|..|||.|...:||..|
  Rat   167 GSGQDAAVALLEDRFQPNMTLEAAQELLVEAITAGILGDLGSGGSVDACVITAGG 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 60/184 (33%)
proteasome_beta_type_6 16..203 CDD:239731 59/183 (32%)
Psmb10NP_001020808.1 proteasome_beta_type_7 40..226 CDD:239732 59/183 (32%)
Pr_beta_C 233..267 CDD:403609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336626
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.