DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and CG30382

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster


Alignment Length:219 Identity:43/219 - (19%)
Similarity:78/219 - (35%) Gaps:51/219 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIADIVAYSLNYH 81
            |.:|::.....|:....:.:....|...|| .|.|||..:.|..:|..||:::......|.    
  Fly    38 TTVALKSGDCAVVATQKKVTEKNIVPETVT-HLFRITKDIGCAMTGRIADSRSQVQKARYE---- 97

  Fly    82 ENQTNKDALVFEAASEFRNYCYSYR-----------------------ESLLAGIIVAGWDEQRG 123
                         |:.|| |.|.|.                       ..|...:::..:|.:.|
  Fly    98 -------------AANFR-YKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSMVLIAYDNEIG 148

  Fly   124 GQVYSI-PLGGMLTRESCTIGG---SGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGS 184
            ..||.. |.|.....::|::|.   ..:|::    .:.|:||::.|..:......:...:..|..
  Fly   149 PSVYKTDPAGYFSGFKACSVGAKTLEANSYL----EKKYKPNLSEEKAIQLAISCLSSVLAIDFK 209

  Fly   185 SGGVVRIGIITKDGIERRIFYNTE 208
            ..| :.||:::|.....||....|
  Fly   210 PNG-IEIGVVSKSDPTFRILDERE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 40/210 (19%)
proteasome_beta_type_6 16..203 CDD:239731 40/212 (19%)
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 43/219 (20%)
proteasome_alpha_type_6 8..218 CDD:239723 39/203 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441044
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.