DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and Psmb10

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_038668.2 Gene:Psmb10 / 19171 MGIID:1096380 Length:273 Species:Mus musculus


Alignment Length:197 Identity:62/197 - (31%)
Similarity:99/197 - (50%) Gaps:3/197 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIADIVAYSL 78
            |||||..:.|..||::|||:|.::.:.||::..:|:..|..|:|||.:|.||||:....:.|..:
Mouse    38 TGTTIAGLVFRDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADTEMTTRMAASKM 102

  Fly    79 NYHENQTNKDALVFEAASEFRNYCYSYRESLLAGIIVAGWDEQRGGQVYSIPLGGMLTRESCTIG 143
            ..|...|.::..|.......|...:.|:..:.|.::|.|.| ..|.|:|.:...|..:|...|..
Mouse   103 ELHALSTGREPRVATVTRILRQTLFRYQGHVGASLVVGGVD-LNGPQLYEVHPHGSYSRLPFTAL 166

  Fly   144 GSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDG--IERRIFYN 206
            |||.......:.:.::|||.||.....:.:|:...|..|..|||.|...:||..|  ::|.:...
Mouse   167 GSGQGAAVALLEDRFQPNMTLEAAQELLVEAITAGILSDLGSGGNVDACVITAGGAKLQRALSTP 231

  Fly   207 TE 208
            ||
Mouse   232 TE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 58/187 (31%)
proteasome_beta_type_6 16..203 CDD:239731 58/188 (31%)
Psmb10NP_038668.2 20S_bact_beta 39..238 CDD:163402 61/196 (31%)
proteasome_beta_type_7 40..226 CDD:239732 57/186 (31%)
Pr_beta_C 232..267 CDD:289249 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833048
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.