DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and psmb9

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_031747269.1 Gene:psmb9 / 101731954 -ID:- Length:215 Species:Xenopus tropicalis


Alignment Length:208 Identity:102/208 - (49%)
Similarity:137/208 - (65%) Gaps:9/208 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FTDTPVSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIA 71
            :|...|||||||:|||||||||:|:|||.|:|..|.|||.:||..:..::||..||||||.||:|
 Frog     8 YTSCEVSTGTTIIAVEFDGGVVVGSDSRVSAGDAVVNRVFNKLAPVHQRIYCALSGSAADAQAVA 72

  Fly    72 DIVAYSLNYHENQTNKDALVFEAASEFRNYCYSYRESLLAGIIVAGWDEQRGGQVYSIPLGGMLT 136
            |:..|.:..|..:.....||..||:..:...|.|:|.:.|.:||||||.:.|||||. .||||:|
 Frog    73 DMAHYHMEVHSIEMEASPLVLAAANLIKGISYKYKEEIAAHLIVAGWDSKNGGQVYG-TLGGMIT 136

  Fly   137 RESCTIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDGIER 201
            |:...||||||::|||||...::|.|:.|:|.||..:|:..|:..|||||||:.:..:||:|.:.
 Frog   137 RQPFAIGGSGSTYIYGFVDSTFKPGMSREECETFAVQALSLAMERDGSSGGVIYLVTVTKEGTKN 201

  Fly   202 RI--------FYN 206
            ||        |||
 Frog   202 RIISGDNIPRFYN 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 93/185 (50%)
proteasome_beta_type_6 16..203 CDD:239731 92/186 (49%)
psmb9XP_031747269.1 proteasome_beta_type_6 17..203 CDD:239731 92/186 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172133at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.