DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and psmb7.2

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_002941310.2 Gene:psmb7.2 / 100489016 XenbaseID:XB-GENE-479691 Length:279 Species:Xenopus tropicalis


Alignment Length:206 Identity:71/206 - (34%)
Similarity:108/206 - (52%) Gaps:6/206 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIADIVAYSL 78
            |||||..:.:..||::|||.|.:....||::...|:..|||.:|||.:|.|||.:.:..:::.:|
 Frog    43 TGTTIAGIIYKDGVILGADRRATDDMVVADKNCAKIHYITDNIYCCGAGVAADAENVTQLLSSNL 107

  Fly    79 NYHENQTNKDALVFEAASEFRNYCYSYRESLLAGIIVAGWDEQRGGQVYSIPLGGMLTRESCTIG 143
            :.|...|.:...|..|....:.:.|.|:..:.|.|||.|.| .:|.|:|||...|...|...|..
 Frog   108 HIHAMTTGRQPRVCTANRILKQFLYRYQGHIGASIIVGGVD-IKGPQLYSIYPHGSTDRVPFTAL 171

  Fly   144 GSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDGIERRIF---Y 205
            ||||:.....:.:.::|||.||:....|.:|:...|..|..||..|.:.||||:  |.||.   .
 Frog   172 GSGSAAAIAVLEDRFKPNMELEEGKRLVTEAITAGIMCDLGSGSGVDLCIITKE--EARILRGHT 234

  Fly   206 NTESGASAVSS 216
            .||:....::|
 Frog   235 TTETRGKKMAS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 64/185 (35%)
proteasome_beta_type_6 16..203 CDD:239731 64/186 (34%)
psmb7.2XP_002941310.2 proteasome_beta_type_7 45..233 CDD:239732 66/190 (35%)
Pr_beta_C 239..270 CDD:372128 1/7 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.