DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and LOC100360846

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001316812.1 Gene:LOC100360846 / 100360846 RGDID:2321312 Length:238 Species:Rattus norvegicus


Alignment Length:218 Identity:121/218 - (55%)
Similarity:160/218 - (73%) Gaps:2/218 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQPDFDFTDTPVSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAA 65
            :.||::  :..||||||||||:||||||:||||||::|:|:|||||||||.|.|.::||||||||
  Rat    21 LTPDWE--NREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAA 83

  Fly    66 DTQAIADIVAYSLNYHENQTNKDALVFEAASEFRNYCYSYRESLLAGIIVAGWDEQRGGQVYSIP 130
            ||||:||.|.|.|.:|..:.|:..||..|||.|:..||.|||.|:||||:||||.|.||||||:|
  Rat    84 DTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVP 148

  Fly   131 LGGMLTRESCTIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIIT 195
            :|||:.|:|..|||||||:|||:|...||..|..::|:.|...|:..|:..|||||||:|:..|.
  Rat   149 MGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKDECLQFTANALALAMERDGSSGGVIRLAAIQ 213

  Fly   196 KDGIERRIFYNTESGASAVSSTP 218
            :.|:||::....:.....:|:.|
  Rat   214 QSGVERQVLLGDQIPKVTISTLP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 112/185 (61%)
proteasome_beta_type_6 16..203 CDD:239731 113/186 (61%)
LOC100360846NP_001316812.1 PRE1 27..212 CDD:223711 113/184 (61%)
proteasome_beta_type_6 34..221 CDD:239731 113/186 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 241 1.000 Domainoid score I2174
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H137657
Inparanoid 1 1.050 256 1.000 Inparanoid score I3084
OMA 1 1.010 - - QHG54145
OrthoDB 1 1.010 - - D1172133at2759
OrthoFinder 1 1.000 - - FOG0001868
OrthoInspector 1 1.000 - - otm44429
orthoMCL 1 0.900 - - OOG6_101390
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1224
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.