DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cype and cox6c

DIOPT Version :9

Sequence 1:NP_001245885.1 Gene:cype / 46040 FlyBaseID:FBgn0015031 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001191053.1 Gene:cox6c / 494577 ZFINID:ZDB-GENE-040724-95 Length:76 Species:Danio rerio


Alignment Length:69 Identity:29/69 - (42%)
Similarity:44/69 - (63%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SSAGPVLRGLHNATIKRNLAVSLGLTAVVTIAYKILVNDPKKAAYADFYSKYDANKSFERMKAAG 72
            |.|.|.:|||....::.:|.::..|:.....|:|..|:||:|.||||||::||:.|.|..|:.||
Zfish     2 SLAKPAMRGLLAKRLRFHLPIAFALSLCAAAAFKFTVSDPRKKAYADFYTQYDSTKEFNAMREAG 66

  Fly    73 RFQS 76
            .|:|
Zfish    67 IFES 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cypeNP_001245885.1 Cyt_c_Oxidase_VIc 8..77 CDD:238467 29/69 (42%)
cox6cNP_001191053.1 Cyt_c_Oxidase_VIc 2..71 CDD:238467 29/69 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10368
eggNOG 1 0.900 - - E1_2E80A
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5376
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1618740at2759
OrthoFinder 1 1.000 - - FOG0006275
OrthoInspector 1 1.000 - - oto39742
orthoMCL 1 0.900 - - OOG6_107937
Panther 1 1.100 - - LDO PTHR12916
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5533
SonicParanoid 1 1.000 - - X5226
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.