DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cype and cox-6C

DIOPT Version :10

Sequence 1:NP_536787.1 Gene:cype / 46040 FlyBaseID:FBgn0015031 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_499867.1 Gene:cox-6C / 176828 WormBaseID:WBGene00017926 Length:90 Species:Caenorhabditis elegans


Alignment Length:74 Identity:19/74 - (25%)
Similarity:29/74 - (39%) Gaps:6/74 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ATSSAGPVLRGLHNATIKRNLAVSLGLTAVVTIAYKILVNDPKKAAYADFYSKYDANKSFERMKA 70
            |.|:...:|.......|..:|..|:|.||.....|.    .|:...|..|::.||.....:.:.|
 Worm     3 AASATRNMLHQYGRRAIGISLIASVGATAAFFFGYV----QPRHEKYERFFANYDPYTRMKEICA 63

  Fly    71 A--GRFQSC 77
            |  |...:|
 Worm    64 ANKGYMHTC 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cypeNP_536787.1 COX6C 10..77 CDD:460756 16/68 (24%)
cox-6CNP_499867.1 COX6C 8..72 CDD:460756 16/67 (24%)

Return to query results.
Submit another query.