powered by:
Protein Alignment cype and cox-6C
DIOPT Version :9
Sequence 1: | NP_001245885.1 |
Gene: | cype / 46040 |
FlyBaseID: | FBgn0015031 |
Length: | 77 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499867.1 |
Gene: | cox-6C / 176828 |
WormBaseID: | WBGene00017926 |
Length: | 90 |
Species: | Caenorhabditis elegans |
Alignment Length: | 74 |
Identity: | 19/74 - (25%) |
Similarity: | 29/74 - (39%) |
Gaps: | 6/74 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 ATSSAGPVLRGLHNATIKRNLAVSLGLTAVVTIAYKILVNDPKKAAYADFYSKYDANKSFERMKA 70
|.|:...:|.......|..:|..|:|.||.....|. .|:...|..|::.||.....:.:.|
Worm 3 AASATRNMLHQYGRRAIGISLIASVGATAAFFFGYV----QPRHEKYERFFANYDPYTRMKEICA 63
Fly 71 A--GRFQSC 77
| |...:|
Worm 64 ANKGYMHTC 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR12916 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.