DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cype and Y111B2A.2

DIOPT Version :9

Sequence 1:NP_001245885.1 Gene:cype / 46040 FlyBaseID:FBgn0015031 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001379273.1 Gene:Y111B2A.2 / 176675 WormBaseID:WBGene00013728 Length:86 Species:Caenorhabditis elegans


Alignment Length:57 Identity:17/57 - (29%)
Similarity:27/57 - (47%) Gaps:2/57 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KRNLAVSLGLTAVVTIAYKILVNDPKKAAYADFYSKYDANKSFERMKAA--GRFQSC 77
            ||.:.|||.:..|.|.|:......|:...|.:|::.||.....:.:.||  |...:|
 Worm    12 KRGIYVSLAVAVVSTAAFNAFYVWPRHNKYEEFFANYDPYTRMKEICAANKGYMHTC 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cypeNP_001245885.1 Cyt_c_Oxidase_VIc 8..77 CDD:238467 16/55 (29%)
Y111B2A.2NP_001379273.1 Cyt_c_Oxidase_VIc 4..68 CDD:413484 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12916
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.