DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cype and COX6C

DIOPT Version :9

Sequence 1:NP_001245885.1 Gene:cype / 46040 FlyBaseID:FBgn0015031 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_004365.1 Gene:COX6C / 1345 HGNCID:2285 Length:75 Species:Homo sapiens


Alignment Length:65 Identity:30/65 - (46%)
Similarity:39/65 - (60%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PVLRGLHNATIKRNLAVSLGLTAVVTIAYKILVNDPKKAAYADFYSKYDANKSFERMKAAGRFQS 76
            |.:|||....::.::||:..|:..|...||..|.|.:|.||||||..||..|.||.|:.||.|||
Human     9 PRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQS 73

  Fly    77  76
            Human    74  73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cypeNP_001245885.1 Cyt_c_Oxidase_VIc 8..77 CDD:238467 30/65 (46%)
COX6CNP_004365.1 COX6C 5..74 CDD:367259 30/65 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10710
eggNOG 1 0.900 - - E1_2E80A
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5404
Isobase 1 0.950 - 0 Normalized mean entropy S6591
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1618740at2759
OrthoFinder 1 1.000 - - FOG0006275
OrthoInspector 1 1.000 - - oto90711
orthoMCL 1 0.900 - - OOG6_107937
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5533
SonicParanoid 1 1.000 - - X5226
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.750

Return to query results.
Submit another query.