powered by:
Protein Alignment cype and COX6C
DIOPT Version :9
Sequence 1: | NP_001245885.1 |
Gene: | cype / 46040 |
FlyBaseID: | FBgn0015031 |
Length: | 77 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_004365.1 |
Gene: | COX6C / 1345 |
HGNCID: | 2285 |
Length: | 75 |
Species: | Homo sapiens |
Alignment Length: | 65 |
Identity: | 30/65 - (46%) |
Similarity: | 39/65 - (60%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 PVLRGLHNATIKRNLAVSLGLTAVVTIAYKILVNDPKKAAYADFYSKYDANKSFERMKAAGRFQS 76
|.:|||....::.::||:..|:..|...||..|.|.:|.||||||..||..|.||.|:.||.|||
Human 9 PRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQS 73
Fly 77 76
Human 74 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
59 |
1.000 |
Domainoid score |
I10710 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2E80A |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
59 |
1.000 |
Inparanoid score |
I5404 |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S6591 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1618740at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006275 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto90711 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_107937 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R5533 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X5226 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
13 | 12.750 |
|
Return to query results.
Submit another query.