DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYBPC1 and CG14964

DIOPT Version :9

Sequence 1:XP_006719468.1 Gene:MYBPC1 / 4604 HGNCID:7549 Length:1195 Species:Homo sapiens
Sequence 2:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster


Alignment Length:536 Identity:138/536 - (25%)
Similarity:212/536 - (39%) Gaps:110/536 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   628 NEAGEAHA---------SIKVKVVDFPDPPVAPTVTEVG-----DDWCIMNWEPPAYDGGSPILG 678
            |:.|:.|.         ::..|..:.|.||..|.:|.|.     .|...:.|:.|.:||||||.|
  Fly     3 NQPGKLHTHPQGGRPKKNVHWKSAERPSPPGRPILTPVALPEQQPDVVNLRWDRPLHDGGSPITG 67

Human   679 YFIERKKKQSSRWMRL------NFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPF 737
            |.:|.::..|..|:|.      ..|:| .:..||     |..|:.|.||.|.:|.|..|..|.|.
  Fly    68 YTVEHRRMGSPHWVRATPTPVDRCDVC-ISGLEP-----GWRYQFRCFAENIVGRSDASELSDPL 126

Human   738 -VPL---AVTSP---PTLLTVDSVTDTTVTMRWR----PPDHIGAAGLDGYVLEYCFEGSTSAKQ 791
             |.|   |:|.|   ..|:..::|.|..:..|.|    ||..|... .|||.:           .
  Fly   127 TVTLQRNAITVPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWF-KDGYEI-----------F 179

Human   792 SDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVK 856
            |....:...|..|...::....|.|:.:             ::..|.|.||         .::.|
  Fly   180 SSRRTKIVNDNEASVLVIHQVALTDEGE-------------IKCTATNRAG---------HVITK 222

Human   857 E---IIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSET 917
            .   :..|||||:||..:...|....|.:.|.:...|:|.|.:||..:|..| ...:..:.|:|.
  Fly   223 ARLMVQAPPKIRLPRTYEDGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIAPGGRFEVSNTEK 287

Human   918 DTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKD 982
            ::::.|....|...|:|.::.......::.|..:.:..||.||...|:...:|::..|:||.|.|
  Fly   288 NSLLKIDNVLREDRGEYMVKAWNRLGEDSTSFLVTVTARPNPPGTPKLNMSFGKSATLSWTAPLD 352

Human   983 DGNAAITGYTIQKADKKSMEWFTV-------IEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1040
            ||...|..|.:        |:|.|       .......|.|:.:|:.|:||.|||.:||..||||
  Fly   353 DGGCKIGNYIV--------EYFRVGWNVWLKAATTRALSTTLHDLIEGSEYKFRVKAENPYGLSE 409

Human  1041 DA---------------TMTKESAVIARDGKIYKNPVYEDFDFSEAP---MFTQPLVNTYAIAGY 1087
            .:               |..|.:..||.|.|  ..|..........|   ..:.|.....|..|.
  Fly   410 PSGESELLFIPDPKRGITKPKSATRIAGDEK--DKPKTGAGGMQVPPRRKTLSPPRPQADASTGM 472

Human  1088 NATLNCSVRGNPKPKI 1103
            :...:.|.:..|||::
  Fly   473 SPKQSPSAKRKPKPQL 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYBPC1XP_006719468.1 IG_like 89..184 CDD:214653
Ig 89..173 CDD:299845
I-set 279..362 CDD:254352
Ig 304..363 CDD:299845
I-set 369..453 CDD:254352
IGc2 381..439 CDD:197706
IG_like 466..543 CDD:214653
Ig_C5_MyBP-C 556..641 CDD:143302 3/21 (14%)
IG_like 559..641 CDD:214653 3/21 (14%)
FN3 645..735 CDD:238020 34/100 (34%)
FN3 744..846 CDD:238020 21/108 (19%)
IG_like 872..953 CDD:214653 17/81 (21%)
Ig 882..953 CDD:299845 15/71 (21%)
FN3 957..1040 CDD:238020 30/89 (34%)
I-set 1072..1161 CDD:254352 8/35 (23%)
Ig 1089..1154 CDD:143165 4/15 (27%)
CG14964NP_647779.2 FN3 29..127 CDD:238020 36/103 (35%)
I-set 138..227 CDD:254352 22/122 (18%)
Ig 155..224 CDD:143165 18/102 (18%)
IG_like 243..323 CDD:214653 17/79 (22%)
Ig 250..323 CDD:299845 15/72 (21%)
FN3 327..411 CDD:238020 32/91 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000709
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X825
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.