DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and HIR1

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_201080.1 Gene:HIR1 / 836395 AraportID:AT5G62740 Length:286 Species:Arabidopsis thaliana


Alignment Length:253 Identity:52/253 - (20%)
Similarity:99/253 - (39%) Gaps:52/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DIYSEGLHVRIPW---FQYPIIYDIRSRPRKISSPTGSKDLQMINI--SLRVLSRPDSLNLPY-- 120
            |:...|.|. :||   .|......:|.:...:...|.:||...:|:  |::..:..:..|..|  
plant    26 DVLEPGCHF-LPWCLGSQVAGYLSLRVQQLDVRCETKTKDNVFVNVVASIQYRALANKANDAYYK 89

  Fly   121 LHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSL 185
            |....|      .:.:...:|:::.:.|.....:..|:..::..:.:|| |:|..          
plant    90 LSNTRG------QIQAYVFDVIRASVPKLLLDDVFEQKNDIAKAVEEEL-EKAMS---------- 137

  Fly   186 TELSFGKEYTAAIEAKQVAQQEAQRAVFFV-----------ERAKQEKQQKIVQAEGEAEAAKML 239
               ::|.|....:.......:..:||:..:           |:|:.||..:|.:||||||:..:.
plant   138 ---AYGYEIVQTLIVDIEPDEHVKRAMNEINAAARMRLAANEKAEAEKILQIKRAEGEAESKYLS 199

  Fly   240 GLAV-KQNPAY---LKLRKLRAAQSIARTIASSQNKVYLSADSLMLNIQDSGFDDMTE 293
            ||.: :|..|.   |:...|..|.::..|.|.         |.:.:.:....||.|.|
plant   200 GLGIARQRQAIVDGLRDSVLGFAVNVPGTTAK---------DVMDMVLVTQYFDTMKE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 38/190 (20%)
HIR1NP_201080.1 SPFH_like_u4 10..278 CDD:259805 52/253 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.