DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and PHB3

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_198893.1 Gene:PHB3 / 834077 AraportID:AT5G40770 Length:277 Species:Arabidopsis thaliana


Alignment Length:257 Identity:130/257 - (50%)
Similarity:185/257 - (71%) Gaps:1/257 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KVLAAVGAAAYGVSQSLYTVEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSRPRK 90
            |....:|.||..::.||:||:||.||:||.|..|:......||.|..||..|.|.|:|||::|..
plant    16 KAAFGLGTAATVLNTSLFTVDGGERAVIFDRFRGVMDQTVGEGTHFLIPILQRPHIFDIRTKPHT 80

  Fly    91 ISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLI 155
            .||.:|:|||||:|::|||||||:...|||:.:.||::|||||||||.|||||:|:|:|||.||:
plant    81 FSSISGTKDLQMVNLTLRVLSRPEVSRLPYIFQTLGLEYDEKVLPSIGNEVLKAVVAQFNADQLL 145

  Fly   156 TQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQ 220
            |:|..||.|:|:.|:.||:||||:||||::|.||:|.|::.|:|.||||||||:|:.|.|.:|.|
plant   146 TERPHVSALVRESLITRAKDFNIVLDDVAITHLSYGVEFSRAVEQKQVAQQEAERSKFVVMKADQ 210

  Fly   221 EKQQKIVQAEGEAEAAKMLGLA-VKQNPAYLKLRKLRAAQSIARTIASSQNKVYLSADSLML 281
            |::..:::||||:|||:::..| .|.....::||::.|::.||.|:|.|.|..||.....||
plant   211 ERRAAVIRAEGESEAAQLISDATAKAGMGLIELRRIEASREIASTLARSPNVAYLPGGQSML 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 108/193 (56%)
PHB3NP_198893.1 SPFH_prohibitin 32..226 CDD:259799 108/193 (56%)
vATP-synt_E 213..>253 CDD:419987 12/39 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63567
OrthoDB 1 1.010 - - D1089994at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.