DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and PHB1

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_194580.1 Gene:PHB1 / 828969 AraportID:AT4G28510 Length:288 Species:Arabidopsis thaliana


Alignment Length:278 Identity:155/278 - (55%)
Similarity:212/278 - (76%) Gaps:2/278 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KLGKGGPPGLGIGLKVLAAVGAAAYGVSQSLYTVEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWF 76
            |:..||  .:...|||....|...||.:.|||.||||||||:|:||.||:..:|.||.|:.||||
plant     8 KIPGGG--AISTLLKVGIIGGLGLYGATHSLYNVEGGHRAIMFNRLVGIKDKVYPEGTHLMIPWF 70

  Fly    77 QYPIIYDIRSRPRKISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEV 141
            :.|:|||:|:||..:.|.:||:||||:.|.||||:||.:..||.:::.||.:|.|:|||||.||.
plant    71 ERPVIYDVRARPYLVESTSGSRDLQMVKIGLRVLTRPMADQLPEIYRSLGENYSERVLPSIINET 135

  Fly   142 LKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQ 206
            ||:|:|::|||||||||:.||..|||.|.|||.:||:.|||||:|.|:||||:||||||||||.|
plant   136 LKAVVAQYNASQLITQREAVSREIRKILTERAANFNVALDDVSITNLTFGKEFTAAIEAKQVAAQ 200

  Fly   207 EAQRAVFFVERAKQEKQQKIVQAEGEAEAAKMLGLAVKQNPAYLKLRKLRAAQSIARTIASSQNK 271
            ||:||.|.||:|:|:|:..:::|:|||::|:::|.|:..|.|::.|||:.||:.||:|||:|.||
plant   201 EAERAKFIVEKAEQDKRSAVIRAQGEAKSAQLIGQAIANNQAFITLRKIEAAREIAQTIANSANK 265

  Fly   272 VYLSADSLMLNIQDSGFD 289
            ||||:|.|:||:|....|
plant   266 VYLSSDDLLLNLQGMNLD 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 117/193 (61%)
PHB1NP_194580.1 SPFH_prohibitin 36..230 CDD:259799 117/193 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 224 1.000 Domainoid score I690
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5263
Inparanoid 1 1.050 311 1.000 Inparanoid score I737
OMA 1 1.010 - - QHG63567
OrthoDB 1 1.010 - - D1089994at2759
OrthoFinder 1 1.000 - - FOG0002111
OrthoInspector 1 1.000 - - otm2842
orthoMCL 1 0.900 - - OOG6_101763
Panther 1 1.100 - - LDO PTHR23222
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1399
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.