DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and PHB4

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_189364.1 Gene:PHB4 / 822347 AraportID:AT3G27280 Length:279 Species:Arabidopsis thaliana


Alignment Length:260 Identity:130/260 - (50%)
Similarity:188/260 - (72%) Gaps:2/260 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KVLAAVGAAAYGVSQSLYTVEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSRPRK 90
            |....:|.||..::.|||||:||.||::|.|..|:......||.|..||:.|.|.|||||::|..
plant    16 KAAFGLGVAATALNSSLYTVDGGERAVLFDRFRGVLDQTVGEGTHFLIPYLQTPHIYDIRTKPHT 80

  Fly    91 ISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLI 155
            .||.:|:|||||:|::||||.||:...|||:.:.||::|||||||||.|||||:|:|.|||.||:
plant    81 FSSKSGTKDLQMVNLTLRVLFRPEVSRLPYIFQTLGLEYDEKVLPSIGNEVLKAVVANFNADQLL 145

  Fly   156 TQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQ 220
            |:|.|||.|:|..|::|||:|||.|||:::|.||:|.|::.|:||||||||||:|:.|.|.:|.|
plant   146 TERPQVSALVRDALIKRAREFNIELDDIAITHLSYGAEFSRAVEAKQVAQQEAERSKFVVMKADQ 210

  Fly   221 EKQQKIVQAEGEAEAAKMLGLA-VKQNPAYLKLRKLRAAQSIARTIASSQNKVYL-SADSLMLNI 283
            |::..:::||||:|||:::..| .|.....::||::.|::.:|.|:|.|.|..|| ...|::.|:
plant   211 ERRAAVIRAEGESEAAQLISDATAKAGMGLIELRRIEASREVAATLARSPNVAYLPGGQSMLFNL 275

  Fly   284  283
            plant   276  275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 109/193 (56%)
PHB4NP_189364.1 SPFH_prohibitin 32..226 CDD:259799 109/193 (56%)
vATP-synt_E 213..>254 CDD:419987 12/40 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63567
OrthoDB 1 1.010 - - D1089994at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.