DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and stom

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_017208322.1 Gene:stom / 81534 ZFINID:ZDB-GENE-980526-486 Length:305 Species:Danio rerio


Alignment Length:234 Identity:51/234 - (21%)
Similarity:105/234 - (44%) Gaps:36/234 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RAIIFSRLGGI-QSDIYSEGLHVRIPWFQYPIIYDIRS-----RPRKISSPTGSKDLQMINISLR 108
            ||||| |||.| :......||...:|.....|..|:|:     .|:::.    :||...:::...
Zfish    85 RAIIF-RLGRILRGGAKGPGLFFILPCTDSFINVDMRTITFDIPPQEVL----TKDSVTVSVDGV 144

  Fly   109 VLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERA 173
            |..|..:..|...:    :...:.....:....|::|:...|.:::::.|::::..::..|.:..
Zfish   145 VYYRVQNATLAVAN----ITNADAATRLLAQTTLRNVLGTKNLAEILSDREEIAHSMQSTLDDAT 205

  Fly   174 RDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKM 238
            .|:.|.::.|.:.::..              ..:.|||:.....|.:|.:.|::.||||..|::.
Zfish   206 DDWGIKVERVEIKDVKL--------------PLQLQRAMAAEAEASREARAKVIAAEGEMNASRA 256

  Fly   239 L---GLAVKQNPAYLKLRKLRAAQSIARTIASSQNKVYL 274
            |   .|.:.::|:.|:||.|:.    ..|||:.:|...:
Zfish   257 LKEASLVIAESPSALQLRYLQT----LNTIAAEKNSTII 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 39/191 (20%)
stomXP_017208322.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.