DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and NPHS2

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_055440.1 Gene:NPHS2 / 7827 HGNCID:13394 Length:383 Species:Homo sapiens


Alignment Length:325 Identity:67/325 - (20%)
Similarity:122/325 - (37%) Gaps:83/325 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GKGGPPGLGIGLKVLAAVGAAAYGVSQSLYTVEGGHRAIIFSRLGG-IQSDIYSEGLHVRIPWFQ 77
            |.|....|.:.:.:|..:....:.:...:..|:...|.||| |||. :.......||...:|...
Human    97 GLGACEWLLVLISLLFIIMTFPFSIWFCVKVVQEYERVIIF-RLGHLLPGRAKGPGLFFFLPCLD 160

  Fly    78 YPIIYDIRSRPRKIS-SPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEV 141
            .....|:|.:..:|. ....:||:.::.|......|.::.:|              :|.|:.: |
Human   161 TYHKVDLRLQTLEIPFHEIVTKDMFIMEIDAICYYRMENASL--------------LLSSLAH-V 210

  Fly   142 LKSV--IAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSL-------------TELSFG 191
            .|:|  :.:....:|:..|....:|:.::.:  |:|..:.||.|:.             ..|..|
Human   211 SKAVQFLVQTTMKRLLAHRSLTEILLERKSI--AQDAKVALDSVTCIWGIKVERIEIKDVRLPAG 273

  Fly   192 KEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKMLGLA---VKQNPAYLKLR 253
            .:::.|:||      ||||          :.:.:::.||.|..|::.|.:|   :...||.::||
Human   274 LQHSLAVEA------EAQR----------QAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLR 322

  Fly   254 KLRAAQSIARTIASSQNKVYLSADSLMLNIQDSGFDDMTEKVYKIGTGLPKDWLDARKMASKVAQ 318
            .|...||::                             |||...:...||.|.|:.....|...|
Human   323 YLHTLQSLS-----------------------------TEKPSTVVLPLPFDLLNCLSSPSNRTQ 358

  Fly   319  318
            Human   359  358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 44/210 (21%)
NPHS2NP_055440.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76
SPFH_podocin 122..344 CDD:259809 58/284 (20%)
PHB 123..287 CDD:214581 41/197 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..383 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.