DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and stoml1

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001039193.1 Gene:stoml1 / 734047 XenbaseID:XB-GENE-990189 Length:361 Species:Xenopus tropicalis


Alignment Length:256 Identity:47/256 - (18%)
Similarity:95/256 - (37%) Gaps:81/256 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 HRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSR-----PRKISSPTGSKDLQMINISLR 108
            ::.|:..|||.:|: ....||.:..|........|:|::     |.|:.|..|      :.:|  
 Frog    66 YQRIVIFRLGRVQA-ARGPGLVLLFPLIDQFQRVDMRTKAFSVPPSKVKSRDG------VLVS-- 121

  Fly   109 VLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLK-------SVIAKFNASQLITQ--------- 157
                            :|.|    :...||:.||.       :.:.:..|..|:||         
 Frog   122 ----------------MGAD----IQFCICDPVLSVLSVQDLNFVTRNTAQNLMTQSLGRKYLRE 166

  Fly   158 ----RQQVSLLIRKELVERARDFNIILDDVSLTELSFGK---------EYTAAIEAKQVAQQEAQ 209
                |.:::..::::|.|:.:.:.:.::.|.|...|..:         ..|.|:....:.|...|
 Frog   167 IQNDRARIAEHLKEDLNEQVKPWGLCVERVELALESILQTPENALIVPSVTPAVPCGGIDQLLMQ 231

  Fly   210 RAVFFVERAKQEKQQKIVQAEGEAEAAKMLGLAVKQNPAYLKLRKLRAA--QSIARTIASS 268
                |:...:|       .:..::.:.|...|::||     .|.|:.|:  :|:...:.||
 Frog   232 ----FLALTRQ-------SSGNDSPSLKDTDLSLKQ-----LLSKVEASLTESLVSEVGSS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 37/220 (17%)
stoml1NP_001039193.1 PHB 60..198 CDD:214581 29/160 (18%)
SPFH_SLP-1 75..205 CDD:259814 28/158 (18%)
SCP2 254..357 CDD:280250 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.