DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and Stoml1

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_081218.3 Gene:Stoml1 / 69106 MGIID:1916356 Length:399 Species:Mus musculus


Alignment Length:187 Identity:40/187 - (21%)
Similarity:68/187 - (36%) Gaps:53/187 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSR-----PRKISSPTGSKDLQMINISLRV 109
            |.|:| |||.|::. ...|:.:.:|:.......|:|:|     |.|::|..|:           |
Mouse    87 RMIVF-RLGRIRNP-QGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGA-----------V 138

  Fly   110 LSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAK--FNASQLITQRQQVSLLIRKELVER 172
            ||             :|.|...:    |.:.||..:..|  ..|:::.........|:|:.|.| 
Mouse   139 LS-------------VGADVQFR----IWDPVLSVMAVKDLNTATRMTAHNAMTKALLRRPLQE- 185

  Fly   173 ARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQ---EAQRAVFFVERAKQEKQQKI 226
                      :.:.:|..|.:  ..:|...|.:.   |..|....||...|..|..:
Mouse   186 ----------IQMEKLKIGDQ--LLLEINDVTRAWGLEVDRVELAVEAVLQPPQDSL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 40/187 (21%)
Stoml1NP_081218.3 Tyrosine-type lysosomal sorting signal. /evidence=ECO:0000250|UniProtKB:Q9UBI4, ECO:0000255 6..10
PHB 77..217 CDD:214581 36/172 (21%)
SPFH_SLP-1 94..224 CDD:259814 33/171 (19%)
SCP2 305..396 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.