DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and stoml3b

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001017825.1 Gene:stoml3b / 550523 ZFINID:ZDB-GENE-050417-366 Length:278 Species:Danio rerio


Alignment Length:284 Identity:70/284 - (24%)
Similarity:127/284 - (44%) Gaps:49/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QSKLNDLA---GKLGKGGPPGLGIGLKVLAAVGAAAYGVSQ--SLYTVEGGHRAIIFSRLGGIQS 62
            |||.|.::   |.||..|    .|.:.:.|......:.:|.  |:..|:...||:|| |||.|.:
Zfish    10 QSKQNLISENDGSLGCCG----WILVIISAFFSILVFPISVFISIKIVKEYERAVIF-RLGRITA 69

  Fly    63 -DIYSEGLHVRIPWFQYPIIYDIRS-----RPRKISSPTGSKDLQMINISLRVLSRPDSLNLPY- 120
             .....|:...||.....|..|:|:     .|::|.    :||...:::...|..|   :|.|. 
Zfish    70 RKAKGPGIFFIIPCTDSFIKVDLRTVSFDIPPQEIL----TKDSVTVSVDGVVYFR---VNDPVA 127

  Fly   121 -LHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVS 184
             :......||..::|   ....|::|:...|.:::::.|:.:|..::..|.|....:.|.::.|.
Zfish   128 SVANVSNADYSTRLL---AQTTLRNVLGTKNLAEVLSDREGISHSMQTTLDEATDSWGIKVERVE 189

  Fly   185 LTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKML---GLAVKQN 246
            :.::..              .|:.|||:.....|.:|.:.|::.||||..|::.|   .|.:.::
Zfish   190 IKDVKL--------------PQQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASLVIAES 240

  Fly   247 PAYLKLRKLRAAQSIARTIASSQN 270
            |:.|:||.|:.    ..|||:.:|
Zfish   241 PSALQLRYLQT----LNTIAAEKN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 46/201 (23%)
stoml3bNP_001017825.1 PHB 49..200 CDD:214581 37/175 (21%)
SPFH_like 72..270 CDD:302763 49/217 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.