DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and zgc:112408

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001017597.1 Gene:zgc:112408 / 550260 ZFINID:ZDB-GENE-050417-63 Length:291 Species:Danio rerio


Alignment Length:241 Identity:59/241 - (24%)
Similarity:100/241 - (41%) Gaps:41/241 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSRPRKISSPTGSKDLQMINISLRV 109
            |:...||:|| |||.:.......||...||         .....||:...|.|.|:.    :..|
Zfish    67 VQEYERAVIF-RLGRLLGGAKGPGLFWIIP---------CMDTFRKVDLRTVSFDIP----AQEV 117

  Fly   110 LSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFN----ASQLITQRQQVSLLIRKELV 170
            |:: ||:.         ...|..|...|.|..:.  |.|..    |:|:|.|....::|..|.|.
Zfish   118 LTK-DSVT---------TMVDAVVYYRIFNPTVS--ITKVENANYATQMIAQTTLRNMLGTKSLA 170

  Fly   171 ERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQE----AQRAVFFVERAKQEKQQKIVQAEG 231
            :..:|...:.:.:.....|..|.:...:|..::...:    .|||:.....|.::.:.|::.|||
Zfish   171 DILKDREEMSEQMEAVLYSASKNWGIKVERVELKDVKLPTTLQRAMAAEAEASRDARAKVIAAEG 235

  Fly   232 EAEAAKMLGLA---VKQNPAYLKLRKLRAAQSIARTIASSQNKVYL 274
            |.:|::.|..|   :.::||.|:||.::....    |||.:|...:
Zfish   236 EMKASRALKEAANVMSESPAALQLRYMQTLTE----IASERNSTII 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 47/198 (24%)
zgc:112408NP_001017597.1 HflC 44..290 CDD:223407 59/241 (24%)
SPFH_like 83..283 CDD:302763 51/224 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.