DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and PHB

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001268425.1 Gene:PHB / 5245 HGNCID:8912 Length:272 Species:Homo sapiens


Alignment Length:267 Identity:135/267 - (50%)
Similarity:187/267 - (70%) Gaps:9/267 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KVLAAVG------AAAYG-VSQSLYTVEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYD 83
            ||..::|      |.|.| |:.:||.|:.||||:||.|..|:|..:..||.|..|||.|.|||:|
Human     4 KVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFD 68

  Fly    84 IRSRPRKISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAK 148
            .|||||.:...|||||||.:||:||:|.||.:..||.:...:|.||||:|||||..|:||||:|:
Human    69 CRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVAR 133

  Fly   149 FNASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVF 213
            |:|.:|||||:.||..:..:|.|||..|.:||||||||.|:||||:|.|:||||||||||:||.|
Human   134 FDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARF 198

  Fly   214 FVERAKQEKQQKIVQAEGEAEAAKMLGLAV-KQNPAYLKLRKLRAAQSIARTIASSQNKVYLSA- 276
            .||:|:|:|:..|:.|||:::||:::..:: ......::||||.||:.||..::.|:|..||.| 
Human   199 VVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAG 263

  Fly   277 DSLMLNI 283
            .|::|.:
Human   264 QSVLLQL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 111/193 (58%)
PHBNP_001268425.1 SPFH_prohibitin 27..221 CDD:259799 111/193 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63567
OrthoDB 1 1.010 - - D1089994at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.