DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and CG14736

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster


Alignment Length:231 Identity:54/231 - (23%)
Similarity:102/231 - (44%) Gaps:38/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TVEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRS-----RPRKISSPTGSKDLQMI 103
            |:...:..:|..|||.::..:...||...:|........|:|:     ||:.:.    :||...|
  Fly    81 TIVPEYSRMIILRLGRLRKGLRGPGLVFILPCIDETHRVDMRTDVTNVRPQDVL----TKDSVTI 141

  Fly   104 NISLRV----LSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLL 164
            .::..|    .|..||:        :.||..::....|....|::::.....:.|:|.|||:|..
  Fly   142 TVNAVVYYCIYSPIDSI--------IQVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSRE 198

  Fly   165 IRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQA 229
            |::.:......:.:.::.|.:.:::.    ..::|....::.||.|          |.:.||:.|
  Fly   199 IQQAVAGITYRWGVRVERVDVMDITL----PTSLERSLASEAEAVR----------EARAKIILA 249

  Fly   230 EGEAEAAKMLGLA---VKQNPAYLKLRKLRAAQSIA 262
            |||.:|:|.|..|   :.:|...|:||.|:...|||
  Fly   250 EGELKASKALKEASDVMSENKITLQLRHLQILSSIA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 42/200 (21%)
CG14736NP_001287293.1 PHB 78..225 CDD:214581 31/159 (19%)
SPFH_like 100..305 CDD:302763 49/212 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.