DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and CG31358

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster


Alignment Length:325 Identity:74/325 - (22%)
Similarity:132/325 - (40%) Gaps:80/325 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 HRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSRPRKISSPTGSKDLQMINISLRVLSRP 113
            ||.:|| |||.|:|.: ..||...:|........|||:              .::|:..:.:...
  Fly    59 HRLVIF-RLGRIRSCL-GPGLVFLLPCIDSFNTVDIRT--------------DVVNVDPQEMLTK 107

  Fly   114 DSLNLPY-----------LHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRK 167
            ||:::..           ::..:.||........|....|::::......:|:..|||:||.|::
  Fly   108 DSVSITVNAVVFYCIYDPINSIIKVDDARDATERISQVTLRNIVGSKGLHELLASRQQLSLEIQQ 172

  Fly   168 ELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGE 232
            .:.:....:.:.::.|.|.|:|.    .:::|....::.||.|          |.:.||:.||||
  Fly   173 AVAKITERWGVRVERVDLMEISL----PSSLERSLASEAEATR----------EARAKIILAEGE 223

  Fly   233 AEAAKML---GLAVKQNPAYLKLRKLRAAQSIARTIASSQNKVYL-----------------SAD 277
            |:|:|.|   ...:.:|...|:||.|:...|:|     |:.:|.:                 |:|
  Fly   224 AKASKALKECSDVMSENQITLQLRHLQILCSMA-----SERRVNVLFPIPLEIMAPFMDGKDSSD 283

  Fly   278 SLMLNIQDSGFDD-------MTEKVYKIGTGLPKDWLDARKMASKVAQPAEKEKNVGNVASSMAE 335
            :...:......||       .:.|||..||  |.|:.:..:..|...:|     .||....|:.|
  Fly   284 AAQDDDDRRDSDDDYDYLHLFSPKVYISGT--PPDFFNDAQTDSTTEKP-----EVGKTTESVEE 341

  Fly   336  335
              Fly   342  341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 45/197 (23%)
CG31358NP_001287292.1 PHB 50..204 CDD:214581 34/164 (21%)
SPFH_like 74..276 CDD:302763 48/234 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.