DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and STOML2

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_038470.1 Gene:STOML2 / 30968 HGNCID:14559 Length:356 Species:Homo sapiens


Alignment Length:324 Identity:70/324 - (21%)
Similarity:122/324 - (37%) Gaps:93/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 AIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSRPRKISSPTGSKDLQMINISLRVLSRPDS 115
            |.:..|:|.... |...||::.||         :..|.|.:.|   .|:: :||:..:.....|:
Human    46 AWVVERMGRFHR-ILEPGLNILIP---------VLDRIRYVQS---LKEI-VINVPEQSAVTLDN 96

  Fly   116 LNL------------PYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKE 168
            :.|            || ....||:..|..:..:....::|.:.|.:..::..:|:.::..| .:
Human    97 VTLQIDGVLYLRIMDPY-KASYGVEDPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNASI-VD 159

  Fly   169 LVERARD------FNIILDDVSLTELSFGKEYTAAIEAKQ-----VAQQEAQR--AVFFVERAKQ 220
            .:.:|.|      ....:.|:.:.. ...:.....:||::     |.:.|..|  |:...|..||
Human   160 AINQAADCWGIRCLRYEIKDIHVPP-RVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQ 223

  Fly   221 --------EKQQKIVQAEGEAEA----AKMLGLAVKQNPAYLKLRKLRAAQSIARTIASSQNKVY 273
                    ||.::|.||.|||.|    ||....|::...|.|......||.|:  |:|..    |
Human   224 AQILASEAEKAEQINQAAGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASL--TVAEQ----Y 282

  Fly   274 LSADSLMLNIQDSGFDDMTEKVYKIGTGLPKDWLDARKMASKVAQPAEKEKNVGNVASSMAERM 337
            :||.|                      .|.||       ::.:..|:    |.|:|.|.:|:.|
Human   283 VSAFS----------------------KLAKD-------SNTILLPS----NPGDVTSMVAQAM 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 46/221 (21%)
STOML2NP_038470.1 HflC 41..314 CDD:223407 70/324 (22%)
SPFH_paraslipin 74..184 CDD:259811 19/115 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.