DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and phb1

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_594713.1 Gene:phb1 / 2542354 PomBaseID:SPAC1782.06c Length:282 Species:Schizosaccharomyces pombe


Alignment Length:276 Identity:132/276 - (47%)
Similarity:194/276 - (70%) Gaps:23/276 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LGIGLKVLAAVGAAAYGVSQSLYTVEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIR 85
            :|||..:|          ..|:|.|.||.||::|.||.|:|..:..||.|..|||.|..|:||:|
pombe    15 IGIGFTLL----------QSSIYDVPGGKRAVLFDRLSGVQKQVVQEGTHFLIPWLQKAIVYDVR 69

  Fly    86 SRPRKISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFN 150
            :|||.|::.||||||||::::||||.||:...||.:::.||:||||:|||||.||:||||:|:|:
pombe    70 TRPRNIATTTGSKDLQMVSLTLRVLHRPEVGMLPQIYQNLGLDYDERVLPSIGNEILKSVVAQFD 134

  Fly   151 ASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFV 215
            |::|||||:.||..||:|||:||.:|.|.|:|||:|.::||||:|.|:|.||:|||||:||.|.|
pombe   135 AAELITQREVVSAKIRQELVQRATEFGIRLEDVSITHMTFGKEFTKAVERKQIAQQEAERARFLV 199

  Fly   216 ERAKQEKQQKIVQAEGEAEAAKMLGLAV-KQNPAYLKLRKLRAAQSIARTIASSQNKV-YL---- 274
            |:::||:|..:::||||||||.::..|: |...|.:::|:|..::.:|..:|:...:| ||    
pombe   200 EQSEQERQANVIRAEGEAEAADIVSKALDKAGGALIQIRRLETSKEVATALANKGAQVTYLPFGA 264

  Fly   275 -------SADSLMLNI 283
                   |...|:||:
pombe   265 GSNAQSSSGSGLLLNV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 111/193 (58%)
phb1NP_594713.1 PHB 24..186 CDD:214581 91/161 (57%)
SPFH_prohibitin 26..220 CDD:259799 111/193 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63567
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.