DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and 1700071K01Rik

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001028937.1 Gene:1700071K01Rik / 237880 MGIID:3588264 Length:271 Species:Mus musculus


Alignment Length:257 Identity:133/257 - (51%)
Similarity:182/257 - (70%) Gaps:8/257 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KVLAAVG------AAAYG-VSQSLYTVEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYD 83
            ||..::|      |.|.| ||.:||.|:.||||:||.|..|:|..:..||.|..|||.|.|:|:|
Mouse     4 KVFESIGKFGLALAVAGGVVSSALYNVDAGHRAVIFDRFHGVQDIVVGEGTHFLIPWVQKPVIFD 68

  Fly    84 IRSRPRKISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAK 148
            .||:||.|...|||||||.:||:||:|.||.:..||:::..:|.||||:|||||.:|:||||:|:
Mouse    69 CRSQPRNIPVITGSKDLQNVNITLRILFRPVASQLPHIYTNIGQDYDERVLPSITSEILKSVVAR 133

  Fly   149 FNASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVF 213
            |:|.:|||||:.||..:..:|.|||..|.:||||||||.|:||||:|.|:||||||||||:.|.|
Mouse   134 FDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAETARF 198

  Fly   214 FVERAKQEKQQKIVQAEGEAEAAKMLGLAV-KQNPAYLKLRKLRAAQSIARTIASSQNKVYL 274
            .||:|:|:|...|:.|||:|:||:::..:: ......::||||.||:.||..::.|||..||
Mouse   199 VVEKAEQQKVAAIISAEGDAKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSQNVTYL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 110/193 (57%)
1700071K01RikNP_001028937.1 PHB 26..187 CDD:214581 90/160 (56%)
SPFH_prohibitin 27..221 CDD:259799 110/193 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1089994at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.