DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and Stoml3

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_694796.1 Gene:Stoml3 / 229277 MGIID:2388072 Length:287 Species:Mus musculus


Alignment Length:248 Identity:63/248 - (25%)
Similarity:113/248 - (45%) Gaps:48/248 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RAIIFSRLGGIQSD-IYSEGLHVRIPWFQYPIIYDIRS-----RPRKI---SSPTGSKDLQMINI 105
            ||::| |||.||:| ....||.:.:|.....:..|:|:     .|::|   .|.|...|..   :
Mouse    55 RAVVF-RLGRIQADKAKGPGLILVLPCIDVFVKVDLRTVTCNIPPQEILTRDSVTTQVDGV---V 115

  Fly   106 SLRVLSRPDSL-NLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKEL 169
            ..|:.|...:: |:..:|:...:         :....|::|:.....||:::.|:::        
Mouse   116 YYRIYSAVSAVANVNDVHQATFL---------LAQTTLRNVLGTQTLSQILSGREEI-------- 163

  Fly   170 VERARDFNIILDDVSLTELSFGKEYTAAIEAKQV-AQQEAQRAVFFVERAKQEKQQKIVQAEGEA 233
               |.....:|||.  ||| :|.. .|.:|.|.| ...:.||::.....|.:|.:.|::.||||.
Mouse   164 ---AHSIQTLLDDA--TEL-WGIR-VARVEIKDVRIPVQLQRSMAAEAEATREARAKVLAAEGEM 221

  Fly   234 EAAKML---GLAVKQNPAYLKLRKLRAAQSIARTIASSQNKVYLSADSLMLNI 283
            .|:|.|   .:.:.::|..|:||.|:.    ..|:|:.:|...:.  .|.:||
Mouse   222 NASKSLKSASMVLAESPVALQLRYLQT----LTTVATEKNSTIVF--PLPMNI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 49/196 (25%)
Stoml3NP_694796.1 PHB 45..200 CDD:214581 42/172 (24%)
SPFH_like 69..267 CDD:302763 52/230 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.