DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and STOM

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_004090.4 Gene:STOM / 2040 HGNCID:3383 Length:288 Species:Homo sapiens


Alignment Length:268 Identity:68/268 - (25%)
Similarity:118/268 - (44%) Gaps:40/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KG-GPPG-LGIGLKVLAAVGAAAYGVSQSLYTVEGGHRAIIFSRLGGI-QSDIYSEGLHVRIPWF 76
            || ||.| :.:....|..|......:...:..::...||||| |||.| |......||...:|..
Human    25 KGLGPCGWILVAFSFLFTVITFPISIWMCIKIIKEYERAIIF-RLGRILQGGAKGPGLFFILPCT 88

  Fly    77 QYPIIYDIRS-----RPRKISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPS 136
            ...|..|:|:     .|::|.    :||...|::...|..|..:..|...:    :...:.....
Human    89 DSFIKVDMRTISFDIPPQEIL----TKDSVTISVDGVVYYRVQNATLAVAN----ITNADSATRL 145

  Fly   137 ICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAK 201
            :....|::|:...|.||:::.|:::           |.:....|||.  |: ::|.: ...:|.|
Human   146 LAQTTLRNVLGTKNLSQILSDREEI-----------AHNMQSTLDDA--TD-AWGIK-VERVEIK 195

  Fly   202 QV-AQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKML---GLAVKQNPAYLKLRKLRAAQSIA 262
            .| ...:.|||:.....|.:|.:.|::.||||..|::.|   .:.:.::||.|:||.|:.    .
Human   196 DVKLPVQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQT----L 256

  Fly   263 RTIASSQN 270
            .|||:.:|
Human   257 TTIAAEKN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 49/200 (25%)
STOMNP_004090.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
SPFH_stomatin 73..274 CDD:259801 52/219 (24%)
Required for homooligomerization 265..273 68/268 (25%)
Required for lipid raft association 267..269
Interaction with LANCL1. /evidence=ECO:0000269|PubMed:9512664 273..287
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.