DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and sto-6

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_509943.1 Gene:sto-6 / 190619 WormBaseID:WBGene00006068 Length:298 Species:Caenorhabditis elegans


Alignment Length:222 Identity:45/222 - (20%)
Similarity:96/222 - (43%) Gaps:32/222 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RAIIFSRLGGIQ-SDIYSEGLHVRIPWFQYPIIYDIRS-----RPRKISSPTGSKDLQMINISLR 108
            ||:|| |||.:: ......||...:|........|:|:     .|:::.    |||...:.:...
 Worm    63 RAVIF-RLGRVKPGGARGPGLFFVVPCIDSYKKIDLRTLSFEVPPQELL----SKDAVTVAVDAV 122

  Fly   109 VLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERA 173
            |..|..:..:..::    ::...:....:....|::::.....:::::.|..:||.::..|.|..
 Worm   123 VFFRISNATISVIN----IEDAARSTKLLAQTTLRNILGTKTLTEMLSDRDVISLQMQATLDETT 183

  Fly   174 RDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKM 238
            ..:.:.::.|.:      |:.....:.::|...||:        |.::...||:.||||..|:..
 Worm   184 IPWGVKVERVEM------KDVRLPYQLQRVMAAEAE--------ATRDAMAKIIAAEGEKNASTA 234

  Fly   239 LGLA---VKQNPAYLKLRKLRAAQSIA 262
            |..|   :..:|..::||.|:...||:
 Worm   235 LAEAADVISMSPCAIQLRYLQTLNSIS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 36/191 (19%)
sto-6NP_509943.1 PRK11029 37..>98 CDD:182913 11/35 (31%)
SPFH_like 74..275 CDD:388510 38/210 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.