DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and Phb

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_032857.1 Gene:Phb / 18673 MGIID:97572 Length:272 Species:Mus musculus


Alignment Length:267 Identity:135/267 - (50%)
Similarity:188/267 - (70%) Gaps:9/267 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KVLAAVG------AAAYG-VSQSLYTVEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYD 83
            ||..::|      |.|.| |:.:||.|:.||||:||.|..|:|..:..||.|..|||.|.|||:|
Mouse     4 KVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFD 68

  Fly    84 IRSRPRKISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAK 148
            .|||||.:...|||||||.:||:||:|.||.:..||.::..:|.||||:|||||..|:||||:|:
Mouse    69 CRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVAR 133

  Fly   149 FNASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVF 213
            |:|.:|||||:.||..:..:|.|||..|.:||||||||.|:||||:|.|:||||||||||:||.|
Mouse   134 FDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARF 198

  Fly   214 FVERAKQEKQQKIVQAEGEAEAAKMLGLAV-KQNPAYLKLRKLRAAQSIARTIASSQNKVYLSA- 276
            .||:|:|:|:..|:.|||:::||:::..:: ......::||||.||:.||..::.|:|..||.| 
Mouse   199 VVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAG 263

  Fly   277 DSLMLNI 283
            .|::|.:
Mouse   264 QSVLLQL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 111/193 (58%)
PhbNP_032857.1 SPFH_prohibitin 27..221 CDD:259799 111/193 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63567
OrthoDB 1 1.010 - - D1089994at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.