DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and STOML3

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_660329.1 Gene:STOML3 / 161003 HGNCID:19420 Length:291 Species:Homo sapiens


Alignment Length:290 Identity:69/290 - (23%)
Similarity:124/290 - (42%) Gaps:61/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LGIGLKVLAAVGAAAYGVS-------------QSLYTVEGGHRAIIFSRLGGIQSD-IYSEGLHV 71
            :|:..|.|...|...:.:|             ..|..::...||::| |||.||:| ....||.:
Human    17 VGVNNKRLGVCGWILFSLSFLLVIITFPISIWMCLKIIKEYERAVVF-RLGRIQADKAKGPGLIL 80

  Fly    72 RIPWFQYPIIYDIRS-----RPRKI---SSPTGSKDLQMINISLRVLSRPDSL-NLPYLHKQLGV 127
            .:|.....:..|:|:     .|::|   .|.|...|..   :..|:.|...:: |:..:|:...:
Human    81 VLPCIDVFVKVDLRTVTCNIPPQEILTRDSVTTQVDGV---VYYRIYSAVSAVANVNDVHQATFL 142

  Fly   128 DYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGK 192
                     :....|::|:.....||::..|:::           |.....:|||.  ||| :|.
Human   143 ---------LAQTTLRNVLGTQTLSQILAGREEI-----------AHSIQTLLDDA--TEL-WGI 184

  Fly   193 EYTAAIEAKQV-AQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKML---GLAVKQNPAYLKLR 253
            . .|.:|.|.| ...:.||::.....|.:|.:.|::.||||..|:|.|   .:.:.::|..|:||
Human   185 R-VARVEIKDVRIPVQLQRSMAAEAEATREARAKVLAAEGEMNASKSLKSASMVLAESPIALQLR 248

  Fly   254 KLRAAQSIARTIASSQNKVYLSADSLMLNI 283
            .|:...    |:|:.:|...:.  .|.:||
Human   249 YLQTLS----TVATEKNSTIVF--PLPMNI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 50/204 (25%)
STOML3NP_660329.1 SPFH_like 73..271 CDD:327503 52/230 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.