DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phb2 and Stom

DIOPT Version :9

Sequence 1:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_038543.1 Gene:Stom / 13830 MGIID:95403 Length:284 Species:Mus musculus


Alignment Length:230 Identity:53/230 - (23%)
Similarity:102/230 - (44%) Gaps:36/230 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RAIIFSRLGGI-QSDIYSEGLHVRIPWFQYPIIYDIRS-----RPRKISSPTGSKDLQMINISLR 108
            |.||| |||.| |......||...:|.....|..|:|:     .|:::.    :||...|::...
Mouse    62 RVIIF-RLGRILQGGAKGPGLFFILPCTDSLIKVDMRTISFDIPPQEVL----TKDSVTISVDGV 121

  Fly   109 VLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERA 173
            |..|..:..|...:    :...:.....:....|::.:...|.||:::.|::::..::..|.:..
Mouse   122 VYYRVQNATLAVAN----ITNADSATRLLAQTTLRNALGTKNLSQILSDREEIAHHMQSTLDDAT 182

  Fly   174 RDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKM 238
            .|:.|.::.|.:.::..              ..:.|||:.....|.:|.:.|::.||||..|::.
Mouse   183 DDWGIKVERVEIKDVKL--------------PVQLQRAMAAEAEAAREARAKVIAAEGEMNASRA 233

  Fly   239 L---GLAVKQNPAYLKLRKLRAAQSIARTIASSQN 270
            |   .:.:.::||.|:||.|:.    ..|||:.:|
Mouse   234 LKEASMVITESPAALQLRYLQT----LTTIAAEKN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 41/191 (21%)
StomNP_038543.1 PHB 53..204 CDD:214581 31/164 (19%)
SPFH_stomatin 73..274 CDD:259801 45/218 (21%)
Required for homooligomerization. /evidence=ECO:0000250 265..273 53/230 (23%)
Required for lipid raft association. /evidence=ECO:0000250 267..269
Interaction with LANCL1. /evidence=ECO:0000250 273..284
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.