DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccs and SOD1

DIOPT Version :9

Sequence 1:NP_001163108.1 Gene:Ccs / 46035 FlyBaseID:FBgn0010531 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_000445.1 Gene:SOD1 / 6647 HGNCID:11179 Length:154 Species:Homo sapiens


Alignment Length:171 Identity:72/171 - (42%)
Similarity:95/171 - (55%) Gaps:25/171 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ATGVRAVLSGFGGQSAVALINTTGSVVDKTPIQGVVRFTTITADKKPGVVVDGVVDGLSPGLHGL 123
            ||....||.|.|                  |:||::.|.  ..:....|.|.|.:.||:.||||.
Human     2 ATKAVCVLKGDG------------------PVQGIINFE--QKESNGPVKVWGSIKGLTEGLHGF 46

  Fly   124 HIHESGDTSAGCSSVGEHYNPRQSPHGSPAAGAEERHAGDLGNIRADENGRATFRFVDPVLEVWD 188
            |:||.||.:|||:|.|.|:||....||.|.  .||||.|||||:.||::|.|.....|.|:.:..
Human    47 HVHEFGDNTAGCTSAGPHFNPLSRKHGGPK--DEERHVGDLGNVTADKDGVADVSIEDSVISLSG 109

  Fly   189 ---IIGRAVVLTANADDLGRGGNDQSLIDGNSGERIACGII 226
               ||||.:|:...|||||:|||::|...||:|.|:|||:|
Human   110 DHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CcsNP_001163108.1 PLN02957 1..253 CDD:215516 72/171 (42%)
HMA 5..64 CDD:238219 2/4 (50%)
Cu-Zn_Superoxide_Dismutase 72..223 CDD:238186 62/153 (41%)
SOD1NP_000445.1 Cu-Zn_Superoxide_Dismutase 3..147 CDD:238186 67/165 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D608177at33208
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.