DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccs and Sod1

DIOPT Version :9

Sequence 1:NP_001163108.1 Gene:Ccs / 46035 FlyBaseID:FBgn0010531 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_476735.1 Gene:Sod1 / 39251 FlyBaseID:FBgn0003462 Length:153 Species:Drosophila melanogaster


Alignment Length:142 Identity:63/142 - (44%)
Similarity:81/142 - (57%) Gaps:7/142 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 IQGVVRFTTITADKKPG--VVVDGVVDGLSPGLHGLHIHESGDTSAGCSSVGEHYNPRQSPHGSP 152
            |.|..:.|.....:..|  |.|.|.|.||:.||||.|:||.||.:.||.|.|.|:||....||:|
  Fly     9 INGDAKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSGPHFNPYGKEHGAP 73

  Fly   153 AAGAEERHAGDLGNIRADENGRATFRFVDPVLEVW---DIIGRAVVLTANADDLGRGGNDQSLID 214
            .  .|.||.||||||.|..:........|..:.::   .||||.||:.|:|||||:||::.|...
  Fly    74 V--DENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHADADDLGQGGHELSKST 136

  Fly   215 GNSGERIACGII 226
            ||:|.||.||:|
  Fly   137 GNAGARIGCGVI 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CcsNP_001163108.1 PLN02957 1..253 CDD:215516 63/142 (44%)
HMA 5..64 CDD:238219
Cu-Zn_Superoxide_Dismutase 72..223 CDD:238186 60/137 (44%)
Sod1NP_476735.1 Cu-Zn_Superoxide_Dismutase 2..150 CDD:412632 63/142 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466841
Domainoid 1 1.000 57 1.000 Domainoid score I612
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I436
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D608177at33208
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.