DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccs and sod-1

DIOPT Version :9

Sequence 1:NP_001163108.1 Gene:Ccs / 46035 FlyBaseID:FBgn0010531 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001021956.1 Gene:sod-1 / 174141 WormBaseID:WBGene00004930 Length:180 Species:Caenorhabditis elegans


Alignment Length:165 Identity:61/165 - (36%)
Similarity:97/165 - (58%) Gaps:10/165 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 QSAVALINTTGSVVDKTPIQGVVRFTTITADKKPGVVVDGVVDGLSPGLHGLHIHESGDTSAGCS 136
            ::|..:.|...:|:....:.|.:..|..:.:.:  .|::|.:.||:|||||.|:|:.||::.||.
 Worm    18 EAAQKMSNRAVAVLRGETVTGTIWITQKSENDQ--AVIEGEIKGLTPGLHGFHVHQYGDSTNGCI 80

  Fly   137 SVGEHYNPRQSPHGSPAAGAEERHAGDLGNIRADENGRATFRFVDPVLEVW---DIIGRAVVLTA 198
            |.|.|:||....||.|.  :|.||.|||||:.|..:|.|..:..|.::.::   .::||::|:.|
 Worm    81 SAGPHFNPFGKTHGGPK--SEIRHVGDLGNVEAGADGVAKIKLTDTLVTLYGPNTVVGRSMVVHA 143

  Fly   199 NADDLGRGGND---QSLIDGNSGERIACGIIARSA 230
            ..||||.|..|   :|...||:|.|.|||:||.:|
 Worm   144 GQDDLGEGVGDKAEESKKTGNAGARAACGVIALAA 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CcsNP_001163108.1 PLN02957 1..253 CDD:215516 61/165 (37%)
HMA 5..64 CDD:238219
Cu-Zn_Superoxide_Dismutase 72..223 CDD:238186 55/156 (35%)
sod-1NP_001021956.1 Cu-Zn_Superoxide_Dismutase 26..171 CDD:238186 53/148 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D608177at33208
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.