DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bka and UTP23

DIOPT Version :9

Sequence 1:NP_524867.2 Gene:Bka / 46032 FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_014646.1 Gene:UTP23 / 854165 SGDID:S000005530 Length:254 Species:Saccharomyces cerevisiae


Alignment Length:173 Identity:37/173 - (21%)
Similarity:74/173 - (42%) Gaps:29/173 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IRVKRKKAEDPHQIKVHEATQQSSALFFQYNTQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCL 97
            :|.||.|            :.:...|.:.:..:...||.:::|...:.....:..::..|:...|
Yeast     1 MRQKRAK------------SYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTL 53

  Fly    98 YAKCIPYISDCVRAELEKLGNKYKLALRIISDPRFERLPCLHKGTYAD-----DCL-----VERV 152
            .|.....|:.|....|.:..|...:.|.    .:|||..|.|  ::.|     :|:     :...
Yeast    54 QADVKVMITQCCIQALYETRNDGAINLA----KQFERRRCNH--SFKDPKSPAECIESVVNISGA 112

  Fly   153 RQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIERMPEA 195
            .:|: |:||:.|.||:.::|.:||||::::......:|.:..|
Yeast   113 NKHR-YVVASQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 32/143 (22%)
UTP23NP_014646.1 PIN_ScUtp23p-like 3..150 CDD:350213 34/165 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1412
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.