DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bka and FCF1

DIOPT Version :9

Sequence 1:NP_524867.2 Gene:Bka / 46032 FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_010626.1 Gene:FCF1 / 851939 SGDID:S000002747 Length:189 Species:Saccharomyces cerevisiae


Alignment Length:200 Identity:118/200 - (59%)
Similarity:143/200 - (71%) Gaps:15/200 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKHKKTQK---VKKQRNAQLKRIIKPTDARL-KDQIRVKRKKAEDPHQIKVHEATQQSSALFFQ 61
            |||.|||:|   ||:..|.:       .|.|| |:|..:|.|  |||...:  ...|.|||||||
Yeast     1 MGKAKKTRKFGLVKRTLNTK-------KDQRLKKNQENIKTK--EDPELTR--NIPQVSSALFFQ 54

  Fly    62 YNTQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYKLALRI 126
            ||..:.|||.:::|||||||||:.|:|||:||||||.|||.|.|:|||.|||||||.||::||::
Yeast    55 YNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLGPKYRIALKL 119

  Fly   127 ISDPRFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIER 191
            ..|||.:||.|.|||||||||||.||.|||||||||||..||.|||||||:|:|.|..|.|.||:
Yeast   120 ARDPRIKRLSCSHKGTYADDCLVHRVLQHKCYIVATNDAGLKQRIRKIPGIPLMSVGGHAYVIEK 184

  Fly   192 MPEAY 196
            :|:.:
Yeast   185 LPDVF 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 93/133 (70%)
FCF1NP_010626.1 PIN_Fcf1-like 53..183 CDD:350212 89/129 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343584
Domainoid 1 1.000 149 1.000 Domainoid score I950
eggNOG 1 0.900 - - E1_COG1412
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5706
Inparanoid 1 1.050 227 1.000 Inparanoid score I746
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54043
OrthoFinder 1 1.000 - - FOG0003797
OrthoInspector 1 1.000 - - oto99183
orthoMCL 1 0.900 - - OOG6_101337
Panther 1 1.100 - - LDO PTHR12416
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R437
SonicParanoid 1 1.000 - - X2651
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.