DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bka and AT2G46230

DIOPT Version :9

Sequence 1:NP_524867.2 Gene:Bka / 46032 FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_566068.1 Gene:AT2G46230 / 819231 AraportID:AT2G46230 Length:196 Species:Arabidopsis thaliana


Alignment Length:198 Identity:115/198 - (58%)
Similarity:142/198 - (71%) Gaps:13/198 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKHKKTQKVKKQRNAQLKRIIKPTDAR-LKDQIRVKRKK--AEDPHQIKVHEATQQSSALFFQY 62
            |||.||.||.     |.:|::|.....: .|:::....||  .|.|..:     ....:.|||.|
plant     1 MGKAKKPQKF-----AVVKKMISHKALKHYKEEVLNPNKKDLTELPRNV-----PSVPAGLFFSY 55

  Fly    63 NTQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYKLALRII 127
            |:.|.|||.:::|||||||||:||:|:.:||.|||||.|.|.|:|||.|||||||.||::||||.
plant    56 NSTLVPPYRVLVDTNFINFSIQNKIDLEKGMRDCLYANCTPCITDCVMAELEKLGQKYRVALRIA 120

  Fly   128 SDPRFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIERM 192
            .||.||||||:|||||||||||:||.||||:||||.|:|||.|||||||||||||...||:||::
plant   121 KDPHFERLPCIHKGTYADDCLVDRVTQHKCFIVATCDRDLKRRIRKIPGVPIMYVTNRKYSIEKL 185

  Fly   193 PEA 195
            |||
plant   186 PEA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 97/133 (73%)
AT2G46230NP_566068.1 PIN_Fcf1-like 53..183 CDD:350212 93/129 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 163 1.000 Domainoid score I1242
eggNOG 1 0.900 - - E1_COG1412
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5706
Inparanoid 1 1.050 225 1.000 Inparanoid score I1175
OMA 1 1.010 - - QHG54043
OrthoDB 1 1.010 - - D1338131at2759
OrthoFinder 1 1.000 - - FOG0003797
OrthoInspector 1 1.000 - - otm3415
orthoMCL 1 0.900 - - OOG6_101337
Panther 1 1.100 - - LDO PTHR12416
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2651
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.