DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bka and utp23

DIOPT Version :9

Sequence 1:NP_524867.2 Gene:Bka / 46032 FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001039134.1 Gene:utp23 / 733957 XenbaseID:XB-GENE-969170 Length:246 Species:Xenopus tropicalis


Alignment Length:149 Identity:41/149 - (27%)
Similarity:73/149 - (48%) Gaps:12/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TQQSSA----LFFQYNTQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAE 112
            |:|..|    .|:::|..|..||.::||..|...:::||:.|.:.:...|..:.....|.||..|
 Frog     4 TRQKHAKKYLTFYRFNFGLREPYQVLLDGTFCQAALRNKIQIKEQLPKYLMGEVQLCTSHCVMKE 68

  Fly   113 LEKLGNKYKLALRIISDPRFERLPCLH--KGTYADDCLVERV---RQHKCYIVATNDKDLKNRIR 172
            |:.|| |.....::|:. ||:...|.|  .......||:...   ..|. |.:||.|::|..:::
 Frog    69 LQSLG-KELYGAKLIAQ-RFQVRSCSHFQNPVSGSTCLLSLTADGNPHH-YFIATQDQELAAKVK 130

  Fly   173 KIPGVPIMYVAAHKYAIER 191
            |..|||:|::..:...:::
 Frog   131 KRAGVPLMFIIQNTIVLDK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 38/139 (27%)
utp23NP_001039134.1 PIN_Fcf1-Utp23-H 2..148 CDD:189036 41/146 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.