DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bka and fcf1

DIOPT Version :9

Sequence 1:NP_524867.2 Gene:Bka / 46032 FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001017601.1 Gene:fcf1 / 550264 ZFINID:ZDB-GENE-050417-67 Length:198 Species:Danio rerio


Alignment Length:199 Identity:135/199 - (67%)
Similarity:158/199 - (79%) Gaps:7/199 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKHKKTQKVKKQRNAQLKRIIKPTDARLKDQIRVK--RKKAEDPHQIKVHEATQQSSALFFQYN 63
            |||.||.:|.     |.:||:|...|.|:|::.|.|  :||.|||..||..|..:..|.||||||
Zfish     1 MGKQKKQKKY-----ATMKRMISLKDQRIKEKDRAKTQKKKKEDPSAIKEQEIAKYPSCLFFQYN 60

  Fly    64 TQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYKLALRIIS 128
            |||||||:|::||||||||||.|||:||.|||||||||:|.|:|||.|||||||.||::||||..
Zfish    61 TQLGPPYYILVDTNFINFSIKAKLDVVQSMMDCLYAKCVPCITDCVMAELEKLGMKYRVALRIAK 125

  Fly   129 DPRFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIERMP 193
            ||||:||||.|||||||||||:||.|||||||||.|:|||.||||||||||||::.|:|.|||||
Zfish   126 DPRFDRLPCSHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMP 190

  Fly   194 EAYG 197
            :.||
Zfish   191 DDYG 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 106/133 (80%)
fcf1NP_001017601.1 PIN_Fcf1 55..189 CDD:189034 106/133 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580145
Domainoid 1 1.000 168 1.000 Domainoid score I3806
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5706
Inparanoid 1 1.050 275 1.000 Inparanoid score I2927
OMA 1 1.010 - - QHG54043
OrthoDB 1 1.010 - - D1338131at2759
OrthoFinder 1 1.000 - - FOG0003797
OrthoInspector 1 1.000 - - oto39097
orthoMCL 1 0.900 - - OOG6_101337
Panther 1 1.100 - - LDO PTHR12416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2651
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.