DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bka and FCF1

DIOPT Version :9

Sequence 1:NP_524867.2 Gene:Bka / 46032 FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_057046.1 Gene:FCF1 / 51077 HGNCID:20220 Length:198 Species:Homo sapiens


Alignment Length:199 Identity:138/199 - (69%)
Similarity:159/199 - (79%) Gaps:7/199 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKHKKTQKVKKQRNAQLKRIIKPTDARLKDQIRVKRKKAE--DPHQIKVHEATQQSSALFFQYN 63
            |||.|||:|.     |.:||::...|.|||::.|:|.||.|  ||..:|..|..|..|.||||||
Human     1 MGKQKKTRKY-----ATMKRMLSLRDQRLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYN 60

  Fly    64 TQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYKLALRIIS 128
            |||||||||::||||||||||.|||:||.|||||||||||.|:|||.||:||||.||::||||..
Human    61 TQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEIEKLGQKYRVALRIAK 125

  Fly   129 DPRFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIERMP 193
            |||||||||.|||||||||||:||.|||||||||.|:|||.||||||||||||::.|:|.|||||
Human   126 DPRFERLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMP 190

  Fly   194 EAYG 197
            :.||
Human   191 DDYG 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 108/133 (81%)
FCF1NP_057046.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..47 11/24 (46%)
PIN_Fcf1-like 57..187 CDD:350212 104/129 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146516
Domainoid 1 1.000 170 1.000 Domainoid score I3787
eggNOG 1 0.900 - - E1_COG1412
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5706
Inparanoid 1 1.050 282 1.000 Inparanoid score I2891
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54043
OrthoDB 1 1.010 - - D1338131at2759
OrthoFinder 1 1.000 - - FOG0003797
OrthoInspector 1 1.000 - - oto88896
orthoMCL 1 0.900 - - OOG6_101337
Panther 1 1.100 - - LDO PTHR12416
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R437
SonicParanoid 1 1.000 - - X2651
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.