DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bka and Utp23

DIOPT Version :9

Sequence 1:NP_524867.2 Gene:Bka / 46032 FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001119738.1 Gene:Utp23 / 299900 RGDID:1307179 Length:249 Species:Rattus norvegicus


Alignment Length:147 Identity:38/147 - (25%)
Similarity:68/147 - (46%) Gaps:8/147 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TQQSSAL----FFQYNTQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAE 112
            |:|..|.    ||:.|..:..||.|:||..|...:::.::.:...:...|..:.....:.||..|
  Rat     4 TRQKHAKKHLGFFRNNFGVREPYQILLDGTFCQAALRGRIQLRDQLPRYLMGETQLCTTRCVLKE 68

  Fly   113 LEKLGNKYKLALRIISDPRFERLPCLHKGTYADDCLVERV---RQHKCYIVATNDKDLKNRIRKI 174
            ||.||.:...|..|....:....|.........:||:..|   ..|. |.|||.|::|..:::|.
  Rat    69 LETLGKELYGAKLIAQKCQVRNCPHFKSAVSGSECLLSMVDDGNPHH-YFVATQDQNLSVKVKKN 132

  Fly   175 PGVPIMYVAAHKYAIER 191
            ||:|:|::..:...:::
  Rat   133 PGIPLMFIIQNTIVLDK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 35/141 (25%)
Utp23NP_001119738.1 PIN_Fcf1-Utp23-H 19..148 CDD:350214 33/129 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1412
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.