DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bka and Fcf1

DIOPT Version :9

Sequence 1:NP_524867.2 Gene:Bka / 46032 FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001037700.1 Gene:Fcf1 / 299198 RGDID:1310899 Length:198 Species:Rattus norvegicus


Alignment Length:199 Identity:137/199 - (68%)
Similarity:159/199 - (79%) Gaps:7/199 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKHKKTQKVKKQRNAQLKRIIKPTDARLKDQIRVKRKKAE--DPHQIKVHEATQQSSALFFQYN 63
            |||.|||:|.     |.:||::...|.|||::.|:|.||.|  ||..:|..|..|..|.||||||
  Rat     1 MGKQKKTRKY-----ATMKRMLSLRDERLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYN 60

  Fly    64 TQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYKLALRIIS 128
            |||||||||::||||||||||.|||:||.|||||||||||.|:|||.||:||||.||::||||..
  Rat    61 TQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEIEKLGQKYRVALRIAK 125

  Fly   129 DPRFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIERMP 193
            ||||:||||.|||||||||||:||.|||||||||.|:|||.||||||||||||::.|:|.|||||
  Rat   126 DPRFDRLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYLSNHRYNIERMP 190

  Fly   194 EAYG 197
            :.||
  Rat   191 DDYG 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 107/133 (80%)
Fcf1NP_001037700.1 PIN_Fcf1-like 57..187 CDD:350212 103/129 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340318
Domainoid 1 1.000 168 1.000 Domainoid score I3743
eggNOG 1 0.900 - - E1_COG1412
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5706
Inparanoid 1 1.050 280 1.000 Inparanoid score I2829
OMA 1 1.010 - - QHG54043
OrthoDB 1 1.010 - - D1338131at2759
OrthoFinder 1 1.000 - - FOG0003797
OrthoInspector 1 1.000 - - oto96027
orthoMCL 1 0.900 - - OOG6_101337
Panther 1 1.100 - - LDO PTHR12416
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2651
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.