DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kermit and gipc1

DIOPT Version :9

Sequence 1:NP_001286187.1 Gene:kermit / 46027 FlyBaseID:FBgn0010504 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001011331.1 Gene:gipc1 / 496793 XenbaseID:XB-GENE-493927 Length:332 Species:Xenopus tropicalis


Alignment Length:336 Identity:164/336 - (48%)
Similarity:227/336 - (67%) Gaps:16/336 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLFTRKSPKQGPTSDGGSQFGSRSSMNSGSSQGSHISNNNNNSIPEKTKPP-------LVFHCQ 58
            |||...:..|..|..: ......||::  |.||...:...:..|||....||       ||||.|
 Frog     1 MPLGLGRRKKASPLME-DEDVSERSAL--GVSQAVGMPGGSIASIPPGLPPPAPALRPRLVFHAQ 62

  Fly    59 LAHGSPTGLIHDFSSVRELYQKIAECFDISEKDILFCTLNSHKVDMTRLLGGQIGLDDFIFAHRK 123
            ||||||||.|..||:|:|||.||||.|.|...:::|||||:|::||.:||||||||:||||||.:
 Frog    63 LAHGSPTGRIEGFSNVKELYAKIAEAFTIPVGEVMFCTLNTHRLDMDKLLGGQIGLEDFIFAHVR 127

  Fly   124 GRPKEIEIVKSQDALGLTITDNGAGYAFIKRIKEDSIIDRIEHISVGDHIEKLNGQNMVGKRHYE 188
            |:.||:|:.||:|:|||||||||||:||||||||.|:|.|::.|.|||.||.:||:|::|.||:|
 Frog   128 GQKKELEVYKSEDSLGLTITDNGAGFAFIKRIKEGSVIHRMQLIGVGDMIEAINGKNLIGSRHFE 192

  Fly   189 VARMLKDIATGETFTLRLVEPVRSGFQGIGPRSQSRASGSAGGKNYGSGKETLRFKANGNAQIEP 253
            |||:||::..|..|||:|.||::: |:.||||  |..||.:.|.: .||:.|||.::.|...:|.
 Frog   193 VARILKELPRGRMFTLKLCEPLKA-FEMIGPR--SGLSGISSGTS-PSGRGTLRLRSKGPPTVEQ 253

  Fly   254 -QFDEATVAGIEAINNLLESFMGINDTELASQIWDLGDQKSNSMDFAEAIDNSDLESFGFTDDFI 317
             |........::.:::||||:|||.|:|||..:.:||..|.|..||::|:|.: |..|.|.|:|:
 Frog   254 LQVSVIEEKAVQKVDDLLESYMGIRDSELAGTMVELGMDKQNPDDFSQALDRT-LGDFAFPDEFV 317

  Fly   318 IELWGAITDAR 328
            .::||||.||:
 Frog   318 FDVWGAIGDAK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kermitNP_001286187.1 PDZ_signaling 126..207 CDD:238492 50/80 (63%)
gipc1NP_001011331.1 PDZ_signaling 131..202 CDD:238492 46/70 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5574
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 316 1.000 Inparanoid score I2505
OMA 1 1.010 - - QHG52512
OrthoDB 1 1.010 - - D1442796at2759
OrthoFinder 1 1.000 - - FOG0001655
OrthoInspector 1 1.000 - - otm49466
Panther 1 1.100 - - O PTHR12259
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5104
SonicParanoid 1 1.000 - - X1053
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.