DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NAT1 and AT1G62410

DIOPT Version :9

Sequence 1:NP_001033943.2 Gene:NAT1 / 46020 FlyBaseID:FBgn0010488 Length:1488 Species:Drosophila melanogaster
Sequence 2:NP_176431.1 Gene:AT1G62410 / 842539 AraportID:AT1G62410 Length:223 Species:Arabidopsis thaliana


Alignment Length:218 Identity:69/218 - (31%)
Similarity:98/218 - (44%) Gaps:30/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   551 LKGVILLIFDKALDEPKYSSMYAQLCKRLSEEAPSFDKEPSNSST----FLRLLIAVCRDKFNNR 611
            |:.:..||||||:.||.:..||||||..:..:.|.|  .||...|    |.|:|:..|:..|...
plant    10 LQRLTTLIFDKAVLEPTFCPMYAQLCFDIRHKMPRF--PPSAPKTDEISFKRVLLNTCQKVFERT 72

  Fly   612 LKRDENDNR-PPPENEADEEERRHLAKQRMLGNVKFIGELNKLDMLSKNVLHQCIMELFDKKKKR 675
            ....|...: ..|:.||:.|:...|...|.|||::|.|||....||::.|:.....:|.:     
plant    73 DDLSEEIRKMNAPDQEAEREDEVRLLNLRTLGNLRFCGELFLKRMLTEKVVLAIGQKLLE----- 132

  Fly   676 TAGTQEMCEDME-----CLAQLLKTCGKNLDSEQGKELMNQYFEKLERRSKSSEYPPRIRFMLKD 735
              ..::||...|     ||  .|.|.||.|||...| |||:...:|:..|...:....:|.|:..
plant   133 --DAEQMCPSEEKIIAICL--FLNTVGKKLDSLNSK-LMNEILRRLKNLSNHPQLVMSLRLMVGK 192

  Fly   736 VIELRQ--------NNWVPRKLG 750
            :|.|..        |.|...|.|
plant   193 IIHLHSIGIKSDPINMWEDSKCG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NAT1NP_001033943.2 MIF4G 518..743 CDD:280935 65/209 (31%)
RAM <817..865 CDD:291966
MA3 1128..1241 CDD:214714
W2_eIF4G1_like 1314..1460 CDD:211397
AT1G62410NP_176431.1 MIF4G 9..198 CDD:214713 65/199 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 154 1.000 Domainoid score I1351
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.