DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NAT1 and AT4G30680

DIOPT Version :9

Sequence 1:NP_001033943.2 Gene:NAT1 / 46020 FlyBaseID:FBgn0010488 Length:1488 Species:Drosophila melanogaster
Sequence 2:NP_194797.1 Gene:AT4G30680 / 829191 AraportID:AT4G30680 Length:263 Species:Arabidopsis thaliana


Alignment Length:373 Identity:77/373 - (20%)
Similarity:124/373 - (33%) Gaps:151/373 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly  1029 GAEKLDLDGQAGRKGSH---------------DGKD------QGKNGSV-ERPSTPAGGIGSAKQ 1071
            |...|.|....||.||.               :|.|      :|..|.: :|||....|.|| :|
plant     4 GDSMLSLRPGGGRGGSRRFAPRFTLSSSSDLTNGGDAPSFAVKGSGGLLNDRPSALVQGNGS-QQ 67

  Fly  1072 QKKDKGPNKEELSKKASQYFKDRFYYDEEEDAEVTEIEIKDIDETKTEEADAAPVEVSEVKEDAA 1136
            .|....|.::.:.|...|                                 ..|.||       |
plant    68 PKPVPSPTRQTVEKPKPQ---------------------------------PQPQEV-------A 92

  Fly  1137 IPVTTPDRFTKLVDGFLELKLPEKALKDVCINLLMEVLDRVNDVFLERAVRLLQTLRKQSNIKPN 1201
            .|.||            .|...|.:.|   .|.|:|  :..|...|:.|::.::.|:     .|:
plant    93 PPTTT------------SLNTVELSRK---TNSLLE--EYFNVRLLDEALQCIEELK-----TPS 135

  Fly  1202 IVVEIFKQVVNKMNEREALNPRIVSLVASLL----AKTICEPALLKLSDIANFTDNGQHYPLFLL 1262
            ...|:.|:.::...|:   ||..|..||.||    :|.:..|..|:         ||      .|
plant   136 YHPELVKEAISLGLEK---NPPCVEPVAKLLEHLVSKNVLTPKDLR---------NG------CL 182

  Fly  1263 VLQQLVKVIGKDALEEKFRASKVDLMNSLPEADRNKERLAGILEDRKLSFLYPLLKVQAEMLKQL 1327
            :...::..||.|                ||:|..|...:.|.|...|.|        .:|::|: 
plant   183 LYGSMLDDIGID----------------LPKAPNNFGEILGSLVMAKAS--------DSELVKE- 222

  Fly  1328 QSDPNPNNFYKWIKANVDNKYYKDPGFIQALMTVVVKYVTKE--TTLA 1373
                        |...:.::::|     :|::..|::.|::.  ||.|
plant   223 ------------ILMKMGDEWFK-----KAVLEAVMRSVSESLLTTEA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NAT1NP_001033943.2 MIF4G 518..743 CDD:280935
RAM <817..865 CDD:291966
MA3 1128..1241 CDD:214714 28/116 (24%)
W2_eIF4G1_like 1314..1460 CDD:211397 10/62 (16%)
AT4G30680NP_194797.1 MA3 104..214 CDD:280933 34/153 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D594395at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.